Lineage for d1dszb_ (1dsz B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586782Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2586836Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)
  7. 2586837Species Human (Homo sapiens) [TaxId:9606] [57723] (5 PDB entries)
  8. 2586838Domain d1dszb_: 1dsz B: [45108]
    Other proteins in same PDB: d1dsza_
    protein/DNA complex; complexed with zn

Details for d1dszb_

PDB Entry: 1dsz (more details), 1.7 Å

PDB Description: structure of the rxr/rar dna-binding domain heterodimer in complex with the retinoic acid response element dr1
PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1dszb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
gsftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrc
qycryqkclamgmkreavqeerqr

SCOPe Domain Coordinates for d1dszb_:

Click to download the PDB-style file with coordinates for d1dszb_.
(The format of our PDB-style files is described here.)

Timeline for d1dszb_: