Lineage for d1gnfa_ (1gnf A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892409Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
    single zinc-binding motif
  6. 892410Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 892445Species Mouse (Mus musculus) [TaxId:10090] [57720] (2 PDB entries)
  8. 892447Domain d1gnfa_: 1gnf A: [45107]
    complexed with zn

Details for d1gnfa_

PDB Entry: 1gnf (more details)

PDB Description: solution structure of the n-terminal zinc finger of murine gata-1, nmr, 25 structures
PDB Compounds: (A:) transcription factor gata-1

SCOP Domain Sequences for d1gnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnfa_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]}
gsearecvncgatatplwrrdrtghylcnacglyhkmngqnrplir

SCOP Domain Coordinates for d1gnfa_:

Click to download the PDB-style file with coordinates for d1gnfa_.
(The format of our PDB-style files is described here.)

Timeline for d1gnfa_: