Lineage for d1gnfa1 (1gnf A:200-243)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035588Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 3035589Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 3035600Species Mouse (Mus musculus) [TaxId:10090] [57720] (2 PDB entries)
  8. 3035602Domain d1gnfa1: 1gnf A:200-243 [45107]
    Other proteins in same PDB: d1gnfa2
    complexed with zn

Details for d1gnfa1

PDB Entry: 1gnf (more details)

PDB Description: solution structure of the n-terminal zinc finger of murine gata-1, nmr, 25 structures
PDB Compounds: (A:) transcription factor gata-1

SCOPe Domain Sequences for d1gnfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnfa1 g.39.1.1 (A:200-243) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]}
earecvncgatatplwrrdrtghylcnacglyhkmngqnrplir

SCOPe Domain Coordinates for d1gnfa1:

Click to download the PDB-style file with coordinates for d1gnfa1.
(The format of our PDB-style files is described here.)

Timeline for d1gnfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnfa2