SCOPe 2.08: Domain d1gnfa1: 1gnf A:200-243

Lineage for d1gnfa1 (1gnf A:200-243)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
   single zinc-binding motif

6. Protein Erythroid transcription factor GATA-1 [57718] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57720] (2 PDB entries)

8. Domain d1gnfa1: 1gnf A:200-243 [45107]
   Other proteins in same PDB: d1gnfa2
   complexed with zn

Details for d1gnfa1

PDB Entry: 1gnf

PDB Description: solution structure of the n-terminal zinc finger of murine gata-1, nmr, 25 structures

PDB Compounds: (A:) transcription factor gata-1

SCOPe Domain Sequences for d1gnfa1:

Sequence; same for both SEQRES and ATOM records:

>d1gnfa1 g.39.1.1 (A:200-243) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]}
earecvncgatatplwrrdrtghylcnacglyhkmngqnrplir

Timeline for d1gnfa1:

• d1gnfa1 first appeared (with stable ids) in SCOP 1.55, called d1gnf__
  
• d1gnfa1 appears in SCOPe 2.07