Lineage for d1gaua_ (1gau A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41380Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
  6. 41381Protein Erythroid transcription factor GATA-1 [57718] (2 species)
  7. 41382Species Chicken (Gallus gallus) [TaxId:9031] [57719] (8 PDB entries)
  8. 41387Domain d1gaua_: 1gau A: [45105]

Details for d1gaua_

PDB Entry: 1gau (more details)

PDB Description: solution structure of the specific dna complex of the zinc containing dna binding domain of the erythroid transcription factor gata-1 by multidimensional nmr

SCOP Domain Sequences for d1gaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaua_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus)}
kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss

SCOP Domain Coordinates for d1gaua_:

Click to download the PDB-style file with coordinates for d1gaua_.
(The format of our PDB-style files is described here.)

Timeline for d1gaua_: