Lineage for d3gata_ (3gat A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90358Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 90359Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 90360Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
  6. 90361Protein Erythroid transcription factor GATA-1 [57718] (2 species)
  7. 90362Species Chicken (Gallus gallus) [TaxId:9031] [57719] (8 PDB entries)
  8. 90368Domain d3gata_: 3gat A: [45103]

Details for d3gata_

PDB Entry: 3gat (more details)

PDB Description: solution nmr structure of the c-terminal domain of chicken gata-1 bound to dna, 34 structures

SCOP Domain Sequences for d3gata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus)}
kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss
kgkkrr

SCOP Domain Coordinates for d3gata_:

Click to download the PDB-style file with coordinates for d3gata_.
(The format of our PDB-style files is described here.)

Timeline for d3gata_: