Lineage for d7gata_ (7gat A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244274Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1244275Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1244276Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 1244277Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 1244278Species Chicken (Gallus gallus) [TaxId:9031] [57719] (8 PDB entries)
  8. 1244280Domain d7gata_: 7gat A: [45101]
    protein/DNA complex; complexed with zn; mutant

Details for d7gata_

PDB Entry: 7gat (more details)

PDB Description: solution nmr structure of the l22v mutant dna binding domain of area complexed to a 13 bp dna containing a tgata site, 34 structures
PDB Compounds: (A:) nitrogen regulatory protein area

SCOPe Domain Sequences for d7gata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]}
mkngeqngpttctncftqttpvwrrnpegqplcnacglflklhgvvrplslktdvikkrn
rnsans

SCOPe Domain Coordinates for d7gata_:

Click to download the PDB-style file with coordinates for d7gata_.
(The format of our PDB-style files is described here.)

Timeline for d7gata_: