Lineage for d7gata_ (7gat A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41380Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)
  6. 41381Protein Erythroid transcription factor GATA-1 [57718] (2 species)
  7. 41382Species Chicken (Gallus gallus) [TaxId:9031] [57719] (8 PDB entries)
  8. 41385Domain d7gata_: 7gat A: [45101]

Details for d7gata_

PDB Entry: 7gat (more details)

PDB Description: solution nmr structure of the l22v mutant dna binding domain of area complexed to a 13 bp dna containing a tgata site, 34 structures

SCOP Domain Sequences for d7gata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus)}
mkngeqngpttctncftqttpvwrrnpegqplcnacglflklhgvvrplslktdvikkrn
rnsans

SCOP Domain Coordinates for d7gata_:

Click to download the PDB-style file with coordinates for d7gata_.
(The format of our PDB-style files is described here.)

Timeline for d7gata_: