Lineage for d4gata_ (4gat A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035588Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 3035589Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. 3035595Species Emericella nidulans [TaxId:162425] [161161] (4 PDB entries)
  8. 3035598Domain d4gata_: 4gat A: [45100]
    protein/DNA complex; complexed with zn

Details for d4gata_

PDB Entry: 4gat (more details)

PDB Description: solution nmr structure of the wild type dna binding domain of area complexed to a 13bp dna containing a cgata site, regularized mean structure
PDB Compounds: (A:) nitrogen regulatory protein area

SCOPe Domain Sequences for d4gata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
mkngeqngpttctncftqttplwrrnpegqplcnacglflklhgvvrplslktdvikkrn
rnsans

SCOPe Domain Coordinates for d4gata_:

Click to download the PDB-style file with coordinates for d4gata_.
(The format of our PDB-style files is described here.)

Timeline for d4gata_: