SCOPe 2.02: Domain d6gata_: 6gat A:

Lineage for d6gata_ (6gat A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
   single zinc-binding motif

6. Protein Erythroid transcription factor GATA-1 [57718] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [57719] (8 PDB entries)

8. Domain d6gata_: 6gat A: [45099]
   protein/DNA complex; complexed with zn; mutant

Details for d6gata_

PDB Entry: 6gat

PDB Description: solution nmr structure of the l22v mutant dna binding domain of area complexed to a 13 bp dna containing a tgata site, regularized mean structure

PDB Compounds: (A:) nitrogen regulatory protein area

SCOPe Domain Sequences for d6gata_:

Sequence; same for both SEQRES and ATOM records:

>d6gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]}
mkngeqngpttctncftqttpvwrrnpegqplcnacglflklhgvvrplslktdvikkrn
rnsans

Timeline for d6gata_:

• d6gata_ first appeared (with stable ids) in SCOP 1.55
  
• d6gata_ appears in SCOPe 2.01
  
• d6gata_ appears in SCOPe 2.03
  
• d6gata_ appears in the current release, SCOPe 2.08