Lineage for d1cld__ (1cld -)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343992Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 343993Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repears are related by the pseudo dyad
  5. 343994Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 343995Protein CD2-Lac9 [57711] (1 species)
  7. 343996Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [57712] (1 PDB entry)
  8. 343997Domain d1cld__: 1cld - [45096]
    complexed with cd; mutant

Details for d1cld__

PDB Entry: 1cld (more details)

PDB Description: dna-binding protein

SCOP Domain Sequences for d1cld__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cld__ g.38.1.1 (-) CD2-Lac9 {Milk yeast (Kluyveromyces lactis)}
qacdacrkkkwkcsktvptctnclkynldcvys

SCOP Domain Coordinates for d1cld__:

Click to download the PDB-style file with coordinates for d1cld__.
(The format of our PDB-style files is described here.)

Timeline for d1cld__: