SCOP 1.73: Domain d1qp9c1: 1qp9 C:58-97

Lineage for d1qp9c1 (1qp9 C:58-97)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Hap1 (Cyp1) [57709] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)

8. Domain d1qp9c1: 1qp9 C:58-97 [45093]
   Other proteins in same PDB: d1qp9a2, d1qp9b2, d1qp9c2, d1qp9d2

Details for d1qp9c1

PDB Entry: 1qp9, 2.8 Å

PDB Description: structure of hap1-pc7 complexed to the uas of cyc7

PDB Compounds: (C:) cyp1(hap1-pc7) activatory protein

SCOP Domain Sequences for d1qp9c1:

Sequence; same for both SEQRES and ATOM records:

>d1qp9c1 g.38.1.1 (C:58-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nriplgcticrkrkvkcdklrphcqqctktgvahlchyme

Timeline for d1qp9c1:

• d1qp9c1 first appeared (with stable ids) in SCOP 1.55
  
• d1qp9c1 appears in SCOP 1.71
  
• d1qp9c1 appears in SCOP 1.75
  
• d1qp9c1 appears in the current release, SCOPe 2.08