Lineage for d2hapd1 (2hap D:56-97)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624270Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 624271Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 624272Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 624287Protein Hap1 (Cyp1) [57709] (1 species)
  7. 624288Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)
  8. 624294Domain d2hapd1: 2hap D:56-97 [45090]
    Other proteins in same PDB: d2hapc2, d2hapd2
    protein/DNA complex; complexed with zn; mutant

Details for d2hapd1

PDB Entry: 2hap (more details), 2.5 Å

PDB Description: structure of a hap1-18/dna complex reveals that protein/dna interactions can have direct allosteric effects on transcriptional activation

SCOP Domain Sequences for d2hapd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hapd1 g.38.1.1 (D:56-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae)}
krnriplrcticrkrkvkcdklrphcqqctktgvahlchyme

SCOP Domain Coordinates for d2hapd1:

Click to download the PDB-style file with coordinates for d2hapd1.
(The format of our PDB-style files is described here.)

Timeline for d2hapd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hapd2