| Class g: Small proteins [56992] (72 folds) |
| Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) ![]() duplication: two structural repeats are related by the pseudo dyad |
| Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
| Protein Hap1 (Cyp1) [57709] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries) |
| Domain d2hapd1: 2hap D:56-97 [45090] Other proteins in same PDB: d2hapc2, d2hapd2 protein/DNA complex; complexed with zn; mutant |
PDB Entry: 2hap (more details), 2.5 Å
SCOP Domain Sequences for d2hapd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hapd1 g.38.1.1 (D:56-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae)}
krnriplrcticrkrkvkcdklrphcqqctktgvahlchyme
Timeline for d2hapd1: