| Class g: Small proteins [56992] (66 folds) |
| Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) ![]() duplication: two structural repears are related by the pseudo dyad |
| Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
| Protein Hap1 (Cyp1) [57709] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries) |
| Domain d2hapc1: 2hap C:55-97 [45089] Other proteins in same PDB: d2hapc2, d2hapd2 |
PDB Entry: 2hap (more details), 2.5 Å
SCOP Domain Sequences for d2hapc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hapc1 g.38.1.1 (C:55-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae)}
rkrnriplrcticrkrkvkcdklrphcqqctktgvahlchyme
Timeline for d2hapc1: