SCOP 1.57: Domain d2hapc1: 2hap C:55-97

Lineage for d2hapc1 (2hap C:55-97)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Hap1 (Cyp1) [57709] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)

8. Domain d2hapc1: 2hap C:55-97 [45089]
   Other proteins in same PDB: d2hapc2, d2hapd2

Details for d2hapc1

PDB Entry: 2hap, 2.5 Å

PDB Description: structure of a hap1-18/dna complex reveals that protein/dna interactions can have direct allosteric effects on transcriptional activation

SCOP Domain Sequences for d2hapc1:

Sequence; same for both SEQRES and ATOM records:

>d2hapc1 g.38.1.1 (C:55-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae)}
rkrnriplrcticrkrkvkcdklrphcqqctktgvahlchyme

Timeline for d2hapc1:

• d2hapc1 first appeared (with stable ids) in SCOP 1.55
  
• d2hapc1 appears in SCOP 1.59
  
• d2hapc1 appears in the current release, SCOPe 2.08