SCOP 1.73: Domain d1hwtd1: 1hwt D:55-97

Lineage for d1hwtd1 (1hwt D:55-97)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Hap1 (Cyp1) [57709] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)

8. Domain d1hwtd1: 1hwt D:55-97 [45086]
   Other proteins in same PDB: d1hwtc2, d1hwtd2, d1hwtg2, d1hwth2

Details for d1hwtd1

PDB Entry: 1hwt, 2.5 Å

PDB Description: structure of a hap1/dna complex reveals dramatically asymmetric dna binding by a homodimeric protein

PDB Compounds: (D:) protein (heme activator protein)

SCOP Domain Sequences for d1hwtd1:

Sequence; same for both SEQRES and ATOM records:

>d1hwtd1 g.38.1.1 (D:55-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rkrnriplscticrkrkvkcdklrphcqqctktgvahlchyme

Timeline for d1hwtd1:

• d1hwtd1 first appeared (with stable ids) in SCOP 1.55
  
• d1hwtd1 appears in SCOP 1.71
  
• d1hwtd1 appears in SCOP 1.75
  
• d1hwtd1 appears in the current release, SCOPe 2.08