| Class g: Small proteins [56992] (72 folds) |
| Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) ![]() duplication: two structural repeats are related by the pseudo dyad |
| Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
| Protein Hap1 (Cyp1) [57709] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries) |
| Domain d1hwtc1: 1hwt C:59-97 [45085] Other proteins in same PDB: d1hwtc2, d1hwtd2, d1hwtg2, d1hwth2 |
PDB Entry: 1hwt (more details), 2.5 Å
SCOP Domain Sequences for d1hwtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwtc1 g.38.1.1 (C:59-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae)}
riplscticrkrkvkcdklrphcqqctktgvahlchyme
Timeline for d1hwtc1: