Lineage for d1zmed1 (1zme D:31-66)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90320Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
  4. 90321Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
  5. 90322Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 90352Protein PUT3 [57707] (1 species)
  7. 90353Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries)
  8. 90355Domain d1zmed1: 1zme D:31-66 [45082]
    Other proteins in same PDB: d1zmec2, d1zmed2

Details for d1zmed1

PDB Entry: 1zme (more details), 2.5 Å

PDB Description: crystal structure of put3/dna complex

SCOP Domain Sequences for d1zmed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmed1 g.38.1.1 (D:31-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae)}
svaclscrkrhikcpggnpcqkcvtsnaiceyleps

SCOP Domain Coordinates for d1zmed1:

Click to download the PDB-style file with coordinates for d1zmed1.
(The format of our PDB-style files is described here.)

Timeline for d1zmed1:

90355
d1zmed1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1zmed2