Lineage for d1zmec1 (1zme C:31-66)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343992Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 343993Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repears are related by the pseudo dyad
  5. 343994Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 344026Protein PUT3 [57707] (1 species)
  7. 344027Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries)
  8. 344028Domain d1zmec1: 1zme C:31-66 [45081]
    Other proteins in same PDB: d1zmec2, d1zmed2

Details for d1zmec1

PDB Entry: 1zme (more details), 2.5 Å

PDB Description: crystal structure of put3/dna complex

SCOP Domain Sequences for d1zmec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmec1 g.38.1.1 (C:31-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae)}
svaclscrkrhikcpggnpcqkcvtsnaiceyleps

SCOP Domain Coordinates for d1zmec1:

Click to download the PDB-style file with coordinates for d1zmec1.
(The format of our PDB-style files is described here.)

Timeline for d1zmec1:

344028
d1zmec1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1zmec2