| Class g: Small proteins [56992] (79 folds) |
| Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) ![]() duplication: two structural repeats are related by the pseudo dyad |
| Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
| Protein PPR1 [57705] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57706] (1 PDB entry) |
| Domain d1pyib1: 1pyi B:30-71 [45080] Other proteins in same PDB: d1pyia2, d1pyib2 protein/DNA complex; complexed with zn |
PDB Entry: 1pyi (more details), 3.2 Å
SCOP Domain Sequences for d1pyib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pyib1 g.38.1.1 (B:30-71) PPR1 {Baker's yeast (Saccharomyces cerevisiae)}
srtackrcrlkkikcdqefpsckrcaklevpcvsldpatgkd
Timeline for d1pyib1: