Lineage for d1pyib1 (1pyi B:30-71)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343992Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 343993Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repears are related by the pseudo dyad
  5. 343994Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 344022Protein PPR1 [57705] (1 species)
  7. 344023Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57706] (1 PDB entry)
  8. 344025Domain d1pyib1: 1pyi B:30-71 [45080]
    Other proteins in same PDB: d1pyia2, d1pyib2
    protein/DNA complex; complexed with zn

Details for d1pyib1

PDB Entry: 1pyi (more details), 3.2 Å

PDB Description: crystal structure of a ppr1-dna complex: dna recognition by proteins containing a zn2cys6 binuclear cluster

SCOP Domain Sequences for d1pyib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyib1 g.38.1.1 (B:30-71) PPR1 {Baker's yeast (Saccharomyces cerevisiae)}
srtackrcrlkkikcdqefpsckrcaklevpcvsldpatgkd

SCOP Domain Coordinates for d1pyib1:

Click to download the PDB-style file with coordinates for d1pyib1.
(The format of our PDB-style files is described here.)

Timeline for d1pyib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pyib2