SCOP 1.73: Domain d1pyia1: 1pyi A:30-71

Lineage for d1pyia1 (1pyi A:30-71)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein PPR1 [57705] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57706] (1 PDB entry)

8. Domain d1pyia1: 1pyi A:30-71 [45079]
   Other proteins in same PDB: d1pyia2, d1pyib2

Details for d1pyia1

PDB Entry: 1pyi, 3.2 Å

PDB Description: crystal structure of a ppr1-dna complex: dna recognition by proteins containing a zn2cys6 binuclear cluster

PDB Compounds: (A:) protein (pyrimidine pathway regulator 1)

SCOP Domain Sequences for d1pyia1:

Sequence; same for both SEQRES and ATOM records:

>d1pyia1 g.38.1.1 (A:30-71) PPR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
srtackrcrlkkikcdqefpsckrcaklevpcvsldpatgkd

Timeline for d1pyia1:

• d1pyia1 first appeared (with stable ids) in SCOP 1.55
  
• d1pyia1 appears in SCOP 1.71
  
• d1pyia1 appears in SCOP 1.75
  
• d1pyia1 appears in the current release, SCOPe 2.08