Lineage for d1aw6__ (1aw6 -)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523808Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 523809Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 523810Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 523820Protein Gal4 [57703] (1 species)
  7. 523821Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57704] (2 PDB entries)
  8. 523824Domain d1aw6__: 1aw6 - [45078]

Details for d1aw6__

PDB Entry: 1aw6 (more details)

PDB Description: gal4 (cd), nmr, 24 structures

SCOP Domain Sequences for d1aw6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw6__ g.38.1.1 (-) Gal4 {Baker's yeast (Saccharomyces cerevisiae)}
mkllssieqacdicrlkklkcskekpkcakclknnwecryspk

SCOP Domain Coordinates for d1aw6__:

Click to download the PDB-style file with coordinates for d1aw6__.
(The format of our PDB-style files is described here.)

Timeline for d1aw6__: