SCOPe 2.08: Domain d1fv5a1: 1fv5 A:3-36

Lineage for d1fv5a1 (1fv5 A:3-36)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.2: C2HC finger [57697] (3 proteins)

6. Protein U-shaped transcription factor, different fingers [57698] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries)

8. Domain d1fv5a1: 1fv5 A:3-36 [45075]
   Other proteins in same PDB: d1fv5a2
   the first zinc finger
   complexed with zn

Details for d1fv5a1

PDB Entry: 1fv5

PDB Description: solution structure of the first zinc finger from the drosophila u- shaped transcription factor

PDB Compounds: (A:) first zinc finger of u-shaped

SCOPe Domain Sequences for d1fv5a1:

Sequence; same for both SEQRES and ATOM records:

>d1fv5a1 g.37.1.2 (A:3-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
llkparfmclpcgiafsspstleahqayycshri

Timeline for d1fv5a1:

• d1fv5a1 first appeared (with stable ids) in SCOP 1.55, called d1fv5a_
  
• d1fv5a1 appears in SCOPe 2.07