Lineage for d1fu9a_ (1fu9 A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90196Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
  4. 90197Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) (S)
  5. 90315Family g.37.1.2: C2HC finger [57697] (1 protein)
  6. 90316Protein U-shaped transcription factor, different fingers [57698] (1 species)
  7. 90317Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (2 PDB entries)
  8. 90318Domain d1fu9a_: 1fu9 A: [45074]

Details for d1fu9a_

PDB Entry: 1fu9 (more details)

PDB Description: solution structure of the ninth zinc-finger domain of the u-shaped transcription factor

SCOP Domain Sequences for d1fu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster)}
gsaaevmkkycstcdisfnyvktylahkqfycknkp

SCOP Domain Coordinates for d1fu9a_:

Click to download the PDB-style file with coordinates for d1fu9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fu9a_: