Class g: Small proteins [56992] (56 folds) |
Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) |
Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) |
Family g.37.1.2: C2HC finger [57697] (1 protein) |
Protein U-shaped transcription factor, different fingers [57698] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (2 PDB entries) |
Domain d1fu9a_: 1fu9 A: [45074] |
PDB Entry: 1fu9 (more details)
SCOP Domain Sequences for d1fu9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster)} gsaaevmkkycstcdisfnyvktylahkqfycknkp
Timeline for d1fu9a_: