Lineage for d1fu9a1 (1fu9 A:3-36)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586331Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2586332Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2586652Family g.37.1.2: C2HC finger [57697] (3 proteins)
  6. 2586660Protein U-shaped transcription factor, different fingers [57698] (1 species)
  7. 2586661Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries)
  8. 2586663Domain d1fu9a1: 1fu9 A:3-36 [45074]
    Other proteins in same PDB: d1fu9a2
    the ninth zinc-finger domain
    complexed with zn

Details for d1fu9a1

PDB Entry: 1fu9 (more details)

PDB Description: solution structure of the ninth zinc-finger domain of the u-shaped transcription factor
PDB Compounds: (A:) u-shaped transcriptional cofactor

SCOPe Domain Sequences for d1fu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fu9a1 g.37.1.2 (A:3-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaevmkkycstcdisfnyvktylahkqfycknkp

SCOPe Domain Coordinates for d1fu9a1:

Click to download the PDB-style file with coordinates for d1fu9a1.
(The format of our PDB-style files is described here.)

Timeline for d1fu9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fu9a2