![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.2: C2HC finger [57697] (3 proteins) |
![]() | Protein U-shaped transcription factor, different fingers [57698] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries) |
![]() | Domain d1fu9a1: 1fu9 A:3-36 [45074] Other proteins in same PDB: d1fu9a2 the ninth zinc-finger domain complexed with zn |
PDB Entry: 1fu9 (more details)
SCOPe Domain Sequences for d1fu9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fu9a1 g.37.1.2 (A:3-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aaevmkkycstcdisfnyvktylahkqfycknkp
Timeline for d1fu9a1: