SCOPe 2.08: Domain d1tf6d4: 1tf6 D:101-131

Lineage for d1tf6d4 (1tf6 D:101-131)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
   duplication: consists of 6 fingers
7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [57694] (4 PDB entries)

8. Domain d1tf6d4: 1tf6 D:101-131 [45069]
   protein/DNA complex; protein/RNA complex; complexed with zn

Details for d1tf6d4

PDB Entry: 1tf6, 3.1 Å

PDB Description: co-crystal structure of xenopus tfiiia zinc finger domain bound to the 5s ribosomal rna gene internal control region

PDB Compounds: (D:) protein (transcription factor iiia)

SCOPe Domain Sequences for d1tf6d4:

Sequence; same for both SEQRES and ATOM records:

>d1tf6d4 g.37.1.1 (D:101-131) Transcription factor IIIA, TFIIIA {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kicvyvchfencgkafkkhnqlkvhqfshtq

Timeline for d1tf6d4:

• d1tf6d4 first appeared (with stable ids) in SCOP 1.55
  
• d1tf6d4 appears in SCOPe 2.07