Lineage for d1tf3a1 (1tf3 A:1-40)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
    duplication: consists of 6 fingers
  7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [57694] (4 PDB entries)
  8. 3035231Domain d1tf3a1: 1tf3 A:1-40 [45057]
    fingers 1-3
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d1tf3a1

PDB Entry: 1tf3 (more details)

PDB Description: tfiiia finger 1-3 bound to dna, nmr, 22 structures
PDB Compounds: (A:) transcription factor iiia

SCOPe Domain Sequences for d1tf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mkryicsfadcgaaynknwklqahlskhtge

SCOPe Domain Coordinates for d1tf3a1:

Click to download the PDB-style file with coordinates for d1tf3a1.
(The format of our PDB-style files is described here.)

Timeline for d1tf3a1: