| Class g: Small proteins [56992] (90 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Ying-yang 1 (yy1, zinc finger domain) [57691] (1 species) duplication: consists of 4 fingers |
| Species Human (Homo sapiens) [TaxId:9606] [57692] (1 PDB entry) |
| Domain d1ubdc3: 1ubd C:351-380 [45055] protein/DNA complex; complexed with zn |
PDB Entry: 1ubd (more details), 2.5 Å
SCOPe Domain Sequences for d1ubdc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}
kpfqctfegcgkrfsldfnlrthvrihtgd
Timeline for d1ubdc3: