Lineage for d1ubdc3 (1ubd C:351-380)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462985Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1462986Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1462987Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1463098Protein Ying-yang 1 (yy1, zinc finger domain) [57691] (1 species)
    duplication: consists of 4 fingers
  7. 1463099Species Human (Homo sapiens) [TaxId:9606] [57692] (1 PDB entry)
  8. 1463102Domain d1ubdc3: 1ubd C:351-380 [45055]
    protein/DNA complex; complexed with zn

Details for d1ubdc3

PDB Entry: 1ubd (more details), 2.5 Å

PDB Description: co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element
PDB Compounds: (C:) protein (yy1 zinc finger domain)

SCOPe Domain Sequences for d1ubdc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}
kpfqctfegcgkrfsldfnlrthvrihtgd

SCOPe Domain Coordinates for d1ubdc3:

Click to download the PDB-style file with coordinates for d1ubdc3.
(The format of our PDB-style files is described here.)

Timeline for d1ubdc3: