Class g: Small proteins [56992] (54 folds) |
Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) |
Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins) |
Protein Transactivation domain of cre-bp1/atf-2 [57689] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57690] (1 PDB entry) |
Domain d1bhi__: 1bhi - [45052] |
PDB Entry: 1bhi (more details)
SCOP Domain Sequences for d1bhi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhi__ g.37.1.1 (-) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens)} msddkpflctapgcgqrftnedhlavhkhkhemtlkfg
Timeline for d1bhi__: