Lineage for d1bhi__ (1bhi -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41228Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
  4. 41229Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) (S)
  5. 41230Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins)
  6. 41266Protein Transactivation domain of cre-bp1/atf-2 [57689] (1 species)
  7. 41267Species Human (Homo sapiens) [TaxId:9606] [57690] (1 PDB entry)
  8. 41268Domain d1bhi__: 1bhi - [45052]

Details for d1bhi__

PDB Entry: 1bhi (more details)

PDB Description: structure of transactivation domain of cre-bp1/atf-2, nmr, 20 structures

SCOP Domain Sequences for d1bhi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhi__ g.37.1.1 (-) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens)}
msddkpflctapgcgqrftnedhlavhkhkhemtlkfg

SCOP Domain Coordinates for d1bhi__:

Click to download the PDB-style file with coordinates for d1bhi__.
(The format of our PDB-style files is described here.)

Timeline for d1bhi__: