Lineage for d1bhia_ (1bhi A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586331Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2586332Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2586333Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 2586389Protein Transactivation domain of cre-bp1/atf-2 [57689] (1 species)
  7. 2586390Species Human (Homo sapiens) [TaxId:9606] [57690] (1 PDB entry)
  8. 2586391Domain d1bhia_: 1bhi A: [45052]

Details for d1bhia_

PDB Entry: 1bhi (more details)

PDB Description: structure of transactivation domain of cre-bp1/atf-2, nmr, 20 structures
PDB Compounds: (A:) cre-bp1

SCOPe Domain Sequences for d1bhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]}
msddkpflctapgcgqrftnedhlavhkhkhemtlkfg

SCOPe Domain Coordinates for d1bhia_:

Click to download the PDB-style file with coordinates for d1bhia_.
(The format of our PDB-style files is described here.)

Timeline for d1bhia_: