Lineage for d2glia4 (2gli A:198-228)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035174Protein Five-finger GLI1 [57683] (1 species)
  7. 3035175Species Human (Homo sapiens) [TaxId:9606] [57684] (1 PDB entry)
  8. 3035179Domain d2glia4: 2gli A:198-228 [45044]
    protein/DNA complex; complexed with co

Details for d2glia4

PDB Entry: 2gli (more details), 2.6 Å

PDB Description: five-finger gli/dna complex
PDB Compounds: (A:) protein (five-finger gli)

SCOPe Domain Sequences for d2glia4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}
kpymcehegcskafsnasdrakhqnrthsne

SCOPe Domain Coordinates for d2glia4:

Click to download the PDB-style file with coordinates for d2glia4.
(The format of our PDB-style files is described here.)

Timeline for d2glia4: