Class g: Small proteins [56992] (100 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
Protein Five-finger GLI1 [57683] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57684] (1 PDB entry) |
Domain d2glia4: 2gli A:198-228 [45044] protein/DNA complex; complexed with co |
PDB Entry: 2gli (more details), 2.6 Å
SCOPe Domain Sequences for d2glia4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} kpymcehegcskafsnasdrakhqnrthsne
Timeline for d2glia4:
View in 3D Domains from same chain: (mouse over for more information) d2glia1, d2glia2, d2glia3, d2glia5 |