Lineage for d2glia2 (2gli A:135-167)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704720Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1704721Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1704722Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1704737Protein Five-finger GLI1 [57683] (1 species)
  7. 1704738Species Human (Homo sapiens) [TaxId:9606] [57684] (1 PDB entry)
  8. 1704740Domain d2glia2: 2gli A:135-167 [45042]
    protein/DNA complex; complexed with co

Details for d2glia2

PDB Entry: 2gli (more details), 2.6 Å

PDB Description: five-finger gli/dna complex
PDB Compounds: (A:) protein (five-finger gli)

SCOPe Domain Sequences for d2glia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}
kefvchwggcsrelrpfkaqymlvvhmrrhtge

SCOPe Domain Coordinates for d2glia2:

Click to download the PDB-style file with coordinates for d2glia2.
(The format of our PDB-style files is described here.)

Timeline for d2glia2: