| Class g: Small proteins [56992] (100 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Five-finger GLI1 [57683] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57684] (1 PDB entry) |
| Domain d2glia2: 2gli A:135-167 [45042] protein/DNA complex; complexed with co |
PDB Entry: 2gli (more details), 2.6 Å
SCOPe Domain Sequences for d2glia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}
kefvchwggcsrelrpfkaqymlvvhmrrhtge
Timeline for d2glia2:
View in 3DDomains from same chain: (mouse over for more information) d2glia1, d2glia3, d2glia4, d2glia5 |