Lineage for d1ncsa_ (1ncs A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035205Protein SWI5 zinc-finger domains [57681] (1 species)
  7. 3035206Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57682] (2 PDB entries)
  8. 3035208Domain d1ncsa_: 1ncs A: [45040]
    domain 1; has an extension to the common fold at the N-terminus
    complexed with zn

Details for d1ncsa_

PDB Entry: 1ncs (more details)

PDB Description: nmr study of swi5 zinc finger domain 1
PDB Compounds: (A:) transcriptional factor swi5

SCOPe Domain Sequences for d1ncsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlprgsidkyvkempdktfeclfpgctktfkrrynirshiqthledr

SCOPe Domain Coordinates for d1ncsa_:

Click to download the PDB-style file with coordinates for d1ncsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ncsa_: