SCOPe 2.06: Domain d1pija_: 1pij A:

Lineage for d1pija_ (1pij A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (9 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [57658] (3 PDB entries)

8. Domain d1pija_: 1pij A: [44993]
   complexed with sf4

Details for d1pija_

PDB Entry: 1pij

PDB Description: the three dimensional structure of the paramagnetic protein hipip i from e.halophila through nuclear magnetic resonance

PDB Compounds: (A:) high potential iron sulfur protein

SCOPe Domain Sequences for d1pija_:

Sequence; same for both SEQRES and ATOM records:

>d1pija_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
asepraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlv
kaegwcsvyapas

Timeline for d1pija_:

• d1pija_ first appeared (with stable ids) in SCOP 1.55, called d1pij__
  
• d1pija_ appears in SCOPe 2.05
  
• d1pija_ appears in SCOPe 2.07
  
• d1pija_ appears in the current release, SCOPe 2.08