Lineage for d2hipa_ (2hip A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41193Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
  4. 41194Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 41195Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 41196Protein HIPIP (high potential iron protein) [57654] (6 species)
  7. 41210Species Ectothiorhodospira halophila [TaxId:17] [57658] (3 PDB entries)
  8. 41211Domain d2hipa_: 2hip A: [44991]

Details for d2hipa_

PDB Entry: 2hip (more details), 2.5 Å

PDB Description: the molecular structure of the high potential iron-sulfur protein isolated from ectothiorhodospira halophila determined at 2.5-angstroms resolution

SCOP Domain Sequences for d2hipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hipa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Ectothiorhodospira halophila}
epraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlvka
egwcsvyapas

SCOP Domain Coordinates for d2hipa_:

Click to download the PDB-style file with coordinates for d2hipa_.
(The format of our PDB-style files is described here.)

Timeline for d2hipa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hipb_