Lineage for d3hipb_ (3hip B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035083Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 3035084Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 3035085Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 3035086Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 3035102Species Chromatium purpuratum [TaxId:37487] [57657] (1 PDB entry)
  8. 3035104Domain d3hipb_: 3hip B: [44989]
    complexed with sf4

Details for d3hipb_

PDB Entry: 3hip (more details), 2.8 Å

PDB Description: high-potential iron-sulfur protein from chromatium purpuratum
PDB Compounds: (B:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d3hipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hipb_ g.35.1.1 (B:) HIPIP (high potential iron protein) {Chromatium purpuratum [TaxId: 37487]}
vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
qlfpgklinlsgwcaswtlr

SCOPe Domain Coordinates for d3hipb_:

Click to download the PDB-style file with coordinates for d3hipb_.
(The format of our PDB-style files is described here.)

Timeline for d3hipb_: