Lineage for d3hipa_ (3hip A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41193Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
  4. 41194Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 41195Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 41196Protein HIPIP (high potential iron protein) [57654] (6 species)
  7. 41197Species Chromatium purpuratum [TaxId:37487] [57657] (1 PDB entry)
  8. 41198Domain d3hipa_: 3hip A: [44988]

Details for d3hipa_

PDB Entry: 3hip (more details), 2.8 Å

PDB Description: high-potential iron-sulfur protein from chromatium purpuratum

SCOP Domain Sequences for d3hipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hipa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Chromatium purpuratum}
vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
qlfpgklinlsgwcaswtlrag

SCOP Domain Coordinates for d3hipa_:

Click to download the PDB-style file with coordinates for d3hipa_.
(The format of our PDB-style files is described here.)

Timeline for d3hipa_: