Lineage for d1hrr__ (1hrr -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41193Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
  4. 41194Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 41195Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 41196Protein HIPIP (high potential iron protein) [57654] (6 species)
  7. 41201Species Chromatium vinosum [TaxId:1049] [57656] (7 PDB entries)
  8. 41207Domain d1hrr__: 1hrr - [44985]

Details for d1hrr__

PDB Entry: 1hrr (more details)

PDB Description: the three dimensional structure of the reduced high potential iron- sulfur protein from chromatium vinosum through nmr

SCOP Domain Sequences for d1hrr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrr__ g.35.1.1 (-) HIPIP (high potential iron protein) {Chromatium vinosum}
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag

SCOP Domain Coordinates for d1hrr__:

Click to download the PDB-style file with coordinates for d1hrr__.
(The format of our PDB-style files is described here.)

Timeline for d1hrr__: