Lineage for d1hip__ (1hip -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) 
Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) Protein HIPIP (high potential iron protein) [57654] (6 species) Species Chromatium vinosum [TaxId:1049] [57656] (7 PDB entries) 
Domain d1hip__: 1hip - [44983]
Details for d1hip__
PDB Entry: 1hip (more details), 2 Å
PDB Description: two-angstrom crystal structure of oxidized chromatium high potential iron protein
SCOP Domain Sequences for d1hip__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hip__ g.35.1.1 (-) HIPIP (high potential iron protein) {Chromatium vinosum}
sapanavaadnataialkynqdatkservaaarpglppeeqhcadcqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag
SCOP Domain Coordinates for d1hip__:
Click to download the PDB-style file with coordinates for d1hip__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hip__:
- d1hip__ appears in SCOP 1.57
- d1hip__ appears in the current release, SCOPe 2.08, called d1hipa_
View in 3D