Lineage for d1b0ya_ (1b0y A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639790Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 2639791Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 2639792Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 2639793Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 2639796Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)
  8. 2639797Domain d1b0ya_: 1b0y A: [44980]
    complexed with sf4; mutant

Details for d1b0ya_

PDB Entry: 1b0y (more details), 0.93 Å

PDB Description: mutant h42q of hipip from chromatium vinosum at 0.93a
PDB Compounds: (A:) protein (hipip)

SCOPe Domain Sequences for d1b0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ya_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId: 1049]}
sapanavaadnataialkynqdatkservaaarpglppeeqqcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag

SCOPe Domain Coordinates for d1b0ya_:

Click to download the PDB-style file with coordinates for d1b0ya_.
(The format of our PDB-style files is described here.)

Timeline for d1b0ya_: