Class g: Small proteins [56992] (98 folds) |
Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) |
Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) |
Protein HIPIP (high potential iron protein) [57654] (9 species) |
Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries) |
Domain d1b0ya_: 1b0y A: [44980] complexed with sf4; mutant |
PDB Entry: 1b0y (more details), 0.93 Å
SCOPe Domain Sequences for d1b0ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0ya_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId: 1049]} sapanavaadnataialkynqdatkservaaarpglppeeqqcancqfmqadaagatdew kgcqlfpgklinvngwcaswtlkag
Timeline for d1b0ya_: