Lineage for d1isub_ (1isu B:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41193Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
  4. 41194Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 41195Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 41196Protein HIPIP (high potential iron protein) [57654] (6 species)
  7. 41217Species Rhodocyclus tenuis [TaxId:1066] [57655] (1 PDB entry)
  8. 41219Domain d1isub_: 1isu B: [44979]

Details for d1isub_

PDB Entry: 1isu (more details), 1.5 Å

PDB Description: the three-dimensional structure of the high-potential iron-sulfur protein isolated from the purple phototrophic bacterium rhodocyclus tenuis determined and refined at 1.5 angstroms resolution

SCOP Domain Sequences for d1isub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isub_ g.35.1.1 (B:) HIPIP (high potential iron protein) {Rhodocyclus tenuis}
gtnaamrkafnyqdtakngkkcsgcaqfvpgasptaaggckvipgdnqiapggycdafiv
kk

SCOP Domain Coordinates for d1isub_:

Click to download the PDB-style file with coordinates for d1isub_.
(The format of our PDB-style files is described here.)

Timeline for d1isub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1isua_