Lineage for d1d6ga_ (1d6g A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035066Fold g.33: Cholecystokinin A receptor, N-domain [57641] (1 superfamily)
    a few helical turns and a disulfide-crosslinked loop
  4. 3035067Superfamily g.33.1: Cholecystokinin A receptor, N-domain [57642] (1 family) (S)
    automatically mapped to Pfam PF09193
  5. 3035068Family g.33.1.1: Cholecystokinin A receptor, N-domain [57643] (1 protein)
  6. 3035069Protein Cholecystokinin A receptor, N-domain [57644] (1 species)
  7. 3035070Species Human (Homo sapiens) [TaxId:9606] [57645] (1 PDB entry)
  8. 3035071Domain d1d6ga_: 1d6g A: [44976]
    complex with cholecystokinin-8

Details for d1d6ga_

PDB Entry: 1d6g (more details)

PDB Description: molecular complex of cholecystokinin-8 and n-terminus of the cholecystokinin a receptor by nmr spectroscopy
PDB Compounds: (A:) cholecystokinin type a receptor

SCOPe Domain Sequences for d1d6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ga_ g.33.1.1 (A:) Cholecystokinin A receptor, N-domain {Human (Homo sapiens) [TaxId: 9606]}
mdvvdsllvngsnitppcelglenetlfcldqprpskewqpaqvill

SCOPe Domain Coordinates for d1d6ga_:

Click to download the PDB-style file with coordinates for d1d6ga_.
(The format of our PDB-style files is described here.)

Timeline for d1d6ga_: