Lineage for d2pf1a2 (2pf1 A:36-65)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639696Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. 2639697Superfamily g.32.1: GLA-domain [57630] (2 families) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. 2639698Family g.32.1.1: GLA-domain [57631] (7 proteins)
  6. 2639749Protein Prothrombin [57634] (1 species)
  7. 2639750Species Cow (Bos taurus) [TaxId:9913] [57635] (5 PDB entries)
  8. 2639755Domain d2pf1a2: 2pf1 A:36-65 [44968]
    Other proteins in same PDB: d2pf1a1

Details for d2pf1a2

PDB Entry: 2pf1 (more details), 2.8 Å

PDB Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution
PDB Compounds: (A:) prothrombin fragment 1

SCOPe Domain Sequences for d2pf1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pf1a2 g.32.1.1 (A:36-65) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
satdafwakytacesarnpreklneclegn

SCOPe Domain Coordinates for d2pf1a2:

Click to download the PDB-style file with coordinates for d2pf1a2.
(The format of our PDB-style files is described here.)

Timeline for d2pf1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pf1a1