SCOPe 2.07: Domain d2pf1a2: 2pf1 A:36-65

Lineage for d2pf1a2 (2pf1 A:36-65)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.32: GLA-domain [57629] (1 superfamily)
   Calcium ion-bound

4. Superfamily g.32.1: GLA-domain [57630] (2 families)
   gamma-carboxy-glutamic acid-rich domain

5. Family g.32.1.1: GLA-domain [57631] (7 proteins)

6. Protein Prothrombin [57634] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57635] (5 PDB entries)

8. Domain d2pf1a2: 2pf1 A:36-65 [44968]
   Other proteins in same PDB: d2pf1a1

Details for d2pf1a2

PDB Entry: 2pf1, 2.8 Å

PDB Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution

PDB Compounds: (A:) prothrombin fragment 1

SCOPe Domain Sequences for d2pf1a2:

Sequence; same for both SEQRES and ATOM records:

>d2pf1a2 g.32.1.1 (A:36-65) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
satdafwakytacesarnpreklneclegn

Timeline for d2pf1a2:

• d2pf1a2 first appeared (with stable ids) in SCOP 1.55, called d2pf1_2
  
• d2pf1a2 appears in SCOPe 2.06
  
• d2pf1a2 appears in the current release, SCOPe 2.08