![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.32: GLA-domain [57629] (1 superfamily) Calcium ion-bound |
![]() | Superfamily g.32.1: GLA-domain [57630] (2 families) ![]() gamma-carboxy-glutamic acid-rich domain |
![]() | Family g.32.1.1: GLA-domain [57631] (7 proteins) heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
![]() | Protein Prothrombin [57634] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57635] (5 PDB entries) |
![]() | Domain d2pf1a2: 2pf1 A:36-65 [44968] Other proteins in same PDB: d2pf1a1 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2pf1 (more details), 2.8 Å
SCOPe Domain Sequences for d2pf1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pf1a2 g.32.1.1 (A:36-65) Prothrombin {Cow (Bos taurus) [TaxId: 9913]} satdafwakytacesarnpreklneclegn
Timeline for d2pf1a2: