Class g: Small proteins [56992] (94 folds) |
Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily) disulfide-rich, alpha+beta |
Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) |
Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins) |
Protein Carboxypeptidase inhibitor [57622] (1 species) |
Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries) |
Domain d1dtdb_: 1dtd B: [44962] Other proteins in same PDB: d1dtda_ complexed with glu, zn |
PDB Entry: 1dtd (more details), 1.65 Å
SCOPe Domain Sequences for d1dtdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtdb_ g.30.1.1 (B:) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} desflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrttcipy v
Timeline for d1dtdb_: