SCOP 1.55: Domain d1dtdb_: 1dtd B:

Lineage for d1dtdb_ (1dtd B:)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)

4. Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family)

5. Family g.30.1.1: Carboxypeptidase inhibitor [57621] (1 protein)

6. Protein Carboxypeptidase inhibitor [57622] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (2 PDB entries)

8. Domain d1dtdb_: 1dtd B: [44962]
   Other proteins in same PDB: d1dtda_

Details for d1dtdb_

PDB Entry: 1dtd, 1.65 Å

PDB Description: crystal structure of the complex between the leech carboxypeptidase inhibitor and the human carboxypeptidase a2 (lci-cpa2)

SCOP Domain Sequences for d1dtdb_:

Sequence; same for both SEQRES and ATOM records:

>d1dtdb_ g.30.1.1 (B:) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis)}
desflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrttcipy
v

Timeline for d1dtdb_:

• d1dtdb_ appears in SCOP 1.57
  
• d1dtdb_ appears in the current release, SCOPe 2.08