Lineage for d1dtdb_ (1dtd B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586152Fold g.30: Carboxypeptidase inhibitor [57619] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 2586153Superfamily g.30.1: Carboxypeptidase inhibitor [57620] (1 family) (S)
  5. 2586154Family g.30.1.1: Carboxypeptidase inhibitor [57621] (2 proteins)
  6. 2586155Protein Carboxypeptidase inhibitor [57622] (1 species)
  7. 2586156Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57623] (5 PDB entries)
  8. 2586157Domain d1dtdb_: 1dtd B: [44962]
    Other proteins in same PDB: d1dtda_
    complexed with glu, zn

Details for d1dtdb_

PDB Entry: 1dtd (more details), 1.65 Å

PDB Description: crystal structure of the complex between the leech carboxypeptidase inhibitor and the human carboxypeptidase a2 (lci-cpa2)
PDB Compounds: (B:) Metallocarboxypeptidase inhibitor

SCOPe Domain Sequences for d1dtdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtdb_ g.30.1.1 (B:) Carboxypeptidase inhibitor {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
desflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrttcipy
v

SCOPe Domain Coordinates for d1dtdb_:

Click to download the PDB-style file with coordinates for d1dtdb_.
(The format of our PDB-style files is described here.)

Timeline for d1dtdb_: