SCOPe 2.06: Domain d1qlda1: 1qld A:21-69

Lineage for d1qlda1 (1qld A:21-69)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family)

5. Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein)

6. Protein Endo-1;4-beta-xylanase A CBDX [57617] (2 species)

7. Species Pseudomonas fluorescens, subsp. cellulosa [TaxId:294] [57618] (2 PDB entries)

8. Domain d1qlda1: 1qld A:21-69 [44961]
   Other proteins in same PDB: d1qlda2

Details for d1qlda1

PDB Entry: 1qld

PDB Description: solution structure of type x cbm

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1qlda1:

Sequence; same for both SEQRES and ATOM records:

>d1qlda1 g.29.1.1 (A:21-69) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens, subsp. cellulosa [TaxId: 294]}
gnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg

Timeline for d1qlda1:

• d1qlda1 first appeared (with stable ids) in SCOP 1.55, called d1qlda_
  
• d1qlda1 was called d1qlda_ in SCOPe 2.05
  
• d1qlda1 appears in SCOPe 2.07
  
• d1qlda1 appears in the current release, SCOPe 2.08